PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe4G229400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family HD-ZIP
Protein Properties Length: 763aa    MW: 84049 Da    PI: 5.5578
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe4G229400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox603.9e-1995150156
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        +++  ++t++q++e+e++F+++++p+ ++r+eLA++l+L+  qVk+WFqN+R++ k
  Aqcoe4G229400.1.p  95 KKRYNRHTQHQIQEMESFFKECPHPDDKQRKELARELSLEPLQVKFWFQNKRTQVK 150
                        5677899*********************************************9987 PP

2START208.23.2e-652845051206
                        HHHHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
              START   1 elaeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                        ela +a++el+++a+++ep+W         e +n +e+ q+f+++ +      ++ea+r++g+v+m+++ lve+l+d + qW++++     +
  Aqcoe4G229400.1.p 284 ELAVAAMEELIRMAQVREPLWLPAGtddstEFLNTEEYFQSFPRGIGekpldWKSEASRETGLVIMNHTALVEILMDAN-QWSNMFSgvvsR 374
                        57899****************98878888899************999****99**************************.************ PP

                        EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEE CS
              START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghsk 163
                        a+tlev+s+g      galq+m+ael +lsplvp R+  f+Ry++ + +g+w++vdvS+d+ ++ +    + R++++pSg+li++++ng+sk
  Aqcoe4G229400.1.p 375 AMTLEVLSTGvagnynGALQVMTAELHVLSPLVPtREAFFLRYCKLHAEGTWAVVDVSLDHLRPSS----LSRCRRRPSGCLIQEMPNGYSK 462
                        ***************************************************************976....7********************* PP

                        EEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
              START 164 vtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                        vtw+ehv+ +++++h+l++++v+sgla+gak+wvatl+rqce+
  Aqcoe4G229400.1.p 463 VTWIEHVEIDEKSVHNLYKPFVESGLAFGAKRWVATLDRQCER 505
                        *****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.7E-2175150IPR009057Homeodomain-like
SuperFamilySSF466891.75E-1979152IPR009057Homeodomain-like
PROSITE profilePS5007117.5492152IPR001356Homeobox domain
SMARTSM003893.7E-1893156IPR001356Homeobox domain
CDDcd000861.58E-1894153No hitNo description
PfamPF000468.9E-1795150IPR001356Homeobox domain
PROSITE patternPS000270127150IPR017970Homeobox, conserved site
PROSITE profilePS5084846.975275508IPR002913START domain
SuperFamilySSF559612.06E-34276507No hitNo description
CDDcd088752.64E-125279504No hitNo description
SMARTSM002345.3E-58284505IPR002913START domain
PfamPF018522.8E-54285505IPR002913START domain
Gene3DG3DSA:3.30.530.201.2E-4350504IPR023393START-like domain
SuperFamilySSF559618.1E-24525754No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009913Biological Processepidermal cell differentiation
GO:0048497Biological Processmaintenance of floral organ identity
GO:0048825Biological Processcotyledon development
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 763 aa     Download sequence    Send to blast
MPSGMMIPAR NMPPMMPPSN GRVSEYGSSS LSLSQPNMFE DQSHLLDMIN ENNSQNEGMP  60
GSKLRDDEFD SNKSGSENYE GASGDDQEPN QRKRKKRYNR HTQHQIQEME SFFKECPHPD  120
DKQRKELARE LSLEPLQVKF WFQNKRTQVK NQHERVENSQ LRAENERLRA ENMRYKEALN  180
SSSCPTCGGP TTLGEMSFDE HNLRVENARL REEIDRISGI AAKYVGRPVA ASYPPHEPTR  240
SLDLVVGSIG MQSGGMGDQV FGGGGDILRT IYGTSDLDKP MIIELAVAAM EELIRMAQVR  300
EPLWLPAGTD DSTEFLNTEE YFQSFPRGIG EKPLDWKSEA SRETGLVIMN HTALVEILMD  360
ANQWSNMFSG VVSRAMTLEV LSTGVAGNYN GALQVMTAEL HVLSPLVPTR EAFFLRYCKL  420
HAEGTWAVVD VSLDHLRPSS LSRCRRRPSG CLIQEMPNGY SKVTWIEHVE IDEKSVHNLY  480
KPFVESGLAF GAKRWVATLD RQCERLASVM ATNIPPGDIG VITSQEGRRS MLKLAERMVI  540
SFCSGVSAST AHTWTTLSGT GDDDVRVMTR KSIDDPGRPP GIVLSAATSF WLPVSPKTLF  600
DFLRNENSRN QWDILSNGGV VQEMAHIANG RDPGNCVSLL RVNSANTNQS NMLIIQESCS  660
DATGSLVVYA PVDAVAMNVV LNGGDPDYVA LLPSGFAIFP DKQQRHGVGL ESGCGSLLTV  720
AFQILVDSVP TAKLSLGSVA TVNNLIACTV DRIKAAVTNN SV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19195RKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010657311.10.0PREDICTED: homeobox-leucine zipper protein HDG2 isoform X3
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLD7TEM30.0D7TEM3_VITVI; Putative uncharacterized protein
STRINGVIT_12s0059g02310.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2